{"product_id":"retatrutide","title":"Retatrutide","description":"\u003ch2\u003eAbout Retatrutide\u003c\/h2\u003e\n\u003cp\u003eRetatrutide is a synthetic 39 residue peptide designed to act as a single molecule agonist at three separate receptors, the glucagon receptor, the glucose dependent insulinotropic polypeptide receptor and the glucagon like peptide 1 receptor. Its sequence incorporates alpha aminoisobutyric acid residues that resist enzymatic breakdown, together with a twenty carbon diacid chain attached through a lysine side chain that supports reversible albumin binding. Peptsche supplies it as a lyophilized powder sealed in a single use glass vial, a format stable through transport and cold storage. Peptsche supplies Retatrutide strictly as a research material for controlled laboratory investigation.\u003c\/p\u003e\n\n\u003ch3\u003eAvailable Sizes\u003c\/h3\u003e\n\u003cp\u003eThis listing covers two vial configurations. Every lot is assayed before release, so the stated purity applies to the batch shipped.\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e5mg vial of lyophilized Retatrutide, 99% or greater purity by HPLC\u003c\/li\u003e\n\u003cli\u003e10mg vial of lyophilized Retatrutide, 99% or greater purity by HPLC\u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003ch3\u003eProduct Specifications\u003c\/h3\u003e\n\u003ctable\u003e\u003ctbody\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eProduct\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eRetatrutide (LY3437943)\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eApplication\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eResearch use only. Laboratory and in vitro investigation.\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eAppearance\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eWhite to off white lyophilized powder\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eChemical Formula\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eC\u003csub\u003e221\u003c\/sub\u003eH\u003csub\u003e342\u003c\/sub\u003eN\u003csub\u003e46\u003c\/sub\u003eO\u003csub\u003e68\u003c\/sub\u003e\n\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eMolecular Weight\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eapproximately 4731 g\/mol. No pharmacopoeial monograph exists for this compound, so a precise value to two decimal places is not available from an authoritative source.\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eCAS Number\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e2381089-83-2\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003ePubChem CID\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003ca href=\"https:\/\/pubchem.ncbi.nlm.nih.gov\/compound\/171390338\" target=\"_blank\" rel=\"noopener\"\u003e171390338\u003c\/a\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eSequence\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eA 39 residue triple receptor agonist peptide incorporating alpha aminoisobutyric acid residues and a C20 diacid modified lysine, one letter YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS with a C terminal amide\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eSynonyms\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eLY3437943\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003ePurity\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e99% or greater by HPLC, verified per batch\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eStorage\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eStore sealed at 2 to 8 °C, protected from heat, light and moisture\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eRegulatory Status\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eInvestigational compound in Phase 3 clinical development by Eli Lilly and Company. Not approved as a medicine in any jurisdiction. Not approved for human or veterinary use.\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003c\/tbody\u003e\u003c\/table\u003e\n\n\u003ch2\u003eWhat is Retatrutide?\u003c\/h2\u003e\n\u003cp\u003eRetatrutide sits in a class of engineered peptides described as unimolecular polyagonists, where one chain is tuned to satisfy the binding requirements of several related receptors at once. The three targets belong to the class B G protein coupled receptor family and share evolutionary ancestry, which is what makes a single sequence capable of engaging all of them.\u003c\/p\u003e\n\u003cp\u003eStructurally the peptide carries alpha aminoisobutyric acid substitutions that stabilise helical geometry and blunt proteolytic cleavage, and a twenty carbon diacid attached through a lysine side chain. That lipid modification binds serum albumin reversibly and is the feature investigators cite when describing the extended circulating presence measured in animal work.\u003c\/p\u003e\n\u003cp\u003eThe published record consists of discovery pharmacology and clinical trials conducted by Eli Lilly and Company, the originator. Those findings describe the investigational molecule as studied by its developer under regulated conditions and do not characterise the research grade material offered here. Peptsche makes no claim that this compound produces any outcome in a human or animal subject.\u003c\/p\u003e\n\n\u003ch2\u003eRetatrutide Mechanism of Action (Research Only)\u003c\/h2\u003e\n\u003cp\u003eMechanistic interest centres on the fact that three receptor activities are combined in one chain. The summaries below describe reported receptor level observations, not effects in humans.\u003c\/p\u003e\n\n\u003ch3\u003eSimultaneous Agonism at Three Receptors\u003c\/h3\u003e\n\u003cp\u003eThe compound activates the glucagon receptor, the glucose dependent insulinotropic polypeptide receptor and the glucagon like peptide 1 receptor. All three couple through stimulatory G protein to adenylate cyclase, so cyclic adenosine monophosphate accumulation serves as the common readout across all three assays. Coskun and colleagues characterised relative potency at each receptor in transfected cell systems and reported an unbalanced rather than equal profile across the three targets.\u003c\/p\u003e\n\n\u003ch3\u003eStructural Basis of Triple Receptor Engagement\u003c\/h3\u003e\n\u003cp\u003eDesigning one sequence to satisfy three binding pockets requires compromise at positions that differ between the receptors. The reported approach combines residues drawn from the native ligands of each receptor with unnatural amino acid substitutions at cleavage sensitive positions. Mutagenesis work examines which residues drive selectivity, making the compound a probe for how this receptor family discriminates between related ligands.\u003c\/p\u003e\n\n\u003ch3\u003eAn Investigational Compound with No Approved Reference\u003c\/h3\u003e\n\u003cp\u003eUnlike molecules with an approved counterpart, Retatrutide has no marketed reference product against which laboratory material can be compared. Receptor pharmacology groups use it to ask how a triple agonist profile differs from dual and single agonist ligands in the same assay, and comparisons must rest on published receptor data rather than a pharmacopoeial standard.\u003c\/p\u003e\n\n\u003ch3\u003eIntegrated Mechanistic Profile\u003c\/h3\u003e\n\u003cp\u003eThe published literature describes Retatrutide through three connected themes.\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eTriple receptor engagement.\u003c\/strong\u003e Agonism at glucagon, glucose dependent insulinotropic polypeptide and glucagon like peptide 1 receptors from one entity.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eStructural compromise.\u003c\/strong\u003e Unnatural residue substitution and a C20 diacid chain supporting reversible albumin binding.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eInvestigational status.\u003c\/strong\u003e No approved reference product, so characterisation rests on published receptor pharmacology.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cstrong\u003eNote:\u003c\/strong\u003e Retatrutide is supplied strictly for research use only. It is intended as an experimental compound for qualified laboratory personnel and is not a drug, food or cosmetic.\u003c\/p\u003e\n\u003cp\u003eRetatrutide is supplied exclusively for laboratory research use and is not intended for human or veterinary application.\u003c\/p\u003e\n\n\u003ch2\u003eResearch Applications (Observations from Studies)\u003c\/h2\u003e\n\u003cp\u003eThe areas below describe reported research uses.\u003c\/p\u003e\n\n\u003ch3\u003eMultiplexed Receptor Signalling Assays\u003c\/h3\u003e\n\u003cp\u003eThe characteristic experiment runs three parallel cell lines, each expressing one target receptor, and compares concentration response curves side by side. Reported endpoints include cyclic adenosine monophosphate accumulation, competition binding constants and beta arrestin recruitment.\u003c\/p\u003e\n\n\u003ch3\u003eComparative Polyagonist Pharmacology\u003c\/h3\u003e\n\u003cp\u003eThe compound is frequently placed alongside single and dual receptor agonists to ask what the third receptor activity contributes in a defined assay. Observations from that work belong to the systems and conditions described in each publication.\u003c\/p\u003e\n\n\u003ch3\u003eAnalytical Method Development\u003c\/h3\u003e\n\u003cp\u003eLaboratories building chromatographic or mass spectrometric methods for acylated peptides use material of this kind to establish retention and fragmentation behaviour. Because no pharmacopoeial monograph exists, method work relies on the batch certificate of analysis rather than an official standard.\u003c\/p\u003e\n\n\u003cp\u003eRetatrutide is supplied exclusively for laboratory research use and is not intended for human or veterinary application.\u003c\/p\u003e\n\u003ch2\u003eRetatrutide Compared With Related Research Compounds\u003c\/h2\u003e\n\u003cp\u003eThe table below places Retatrutide alongside two related compounds in the Peptsche range. It is offered to clarify differences in classification, molecular target and research context. It should not be read as a comparison of clinical performance, safety, or suitability for any application.\u003c\/p\u003e\n\u003ctable\u003e\u003ctbody\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eCharacteristic\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003cstrong\u003eRetatrutide\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003cstrong\u003e\u003ca href=\"\/products\/tirzepatide\"\u003eTirzepatide\u003c\/a\u003e\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e\u003cstrong\u003e\u003ca href=\"\/products\/aod-9604\"\u003eAOD-9604\u003c\/a\u003e\u003c\/strong\u003e\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eResearch Classification\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eSynthetic 39 residue peptide acting as a triple glucagon, GIP and GLP-1 receptor agonist\u003c\/td\u003e\n\u003ctd\u003eSynthetic 39 residue peptide acting as a dual GIP and GLP-1 receptor agonist\u003c\/td\u003e\n\u003ctd\u003eSynthetic sixteen residue cyclic analogue of a carboxy terminal region of human growth hormone, not an incretin receptor ligand\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003ePrimary Molecular Target\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eGlucagon receptor, glucose dependent insulinotropic polypeptide receptor and glucagon like peptide 1 receptor\u003c\/td\u003e\n\u003ctd\u003eGlucose dependent insulinotropic polypeptide receptor and glucagon like peptide 1 receptor\u003c\/td\u003e\n\u003ctd\u003eNo defined receptor target. Examined through the lipolytic domain hypothesis in adipose tissue preparations\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eMechanistic Profile\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eSimultaneous agonism at three related class B G protein coupled receptors, reported as an unbalanced rather than equal profile\u003c\/td\u003e\n\u003ctd\u003eDual incretin receptor agonism from one molecular entity, with cyclic adenosine monophosphate accumulation as the usual assay readout\u003c\/td\u003e\n\u003ctd\u003eReproduces a discrete carboxy terminal domain of the parent hormone while omitting its growth promoting region, a route entirely separate from incretin receptor agonism\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003ePrimary Research Focus\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eMultiplexed receptor signalling assays, comparative polyagonist pharmacology, analytical method development\u003c\/td\u003e\n\u003ctd\u003eReceptor binding and cell based signalling assays, islet and adipocyte culture systems, analytical reference work\u003c\/td\u003e\n\u003ctd\u003eAdipose tissue and metabolic assays, animal joint tissue models, analytical detection and in vitro metabolism\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eStructural Design\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003e39 residues with alpha aminoisobutyric acid substitutions and a C20 diacid modified lysine, C terminal amide\u003c\/td\u003e\n\u003ctd\u003e39 residues with two alpha aminoisobutyric acid substitutions and a C20 diacid chain on a lysine side chain, C terminal amide\u003c\/td\u003e\n\u003ctd\u003eSixteen residues closed by a disulfide bridge between cysteines at positions 7 and 14, with a synthetic amino terminal tyrosine\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003ctr\u003e\n\u003ctd\u003e\u003cstrong\u003eRegulatory Status\u003c\/strong\u003e\u003c\/td\u003e\n\u003ctd\u003eInvestigational compound in Phase 3 clinical development by Eli Lilly and Company. Not approved as a medicine in any jurisdiction and not approved for human or veterinary use\u003c\/td\u003e\n\u003ctd\u003eThe molecule is the active ingredient in approved medicines marketed as Mounjaro and Zepbound by Eli Lilly and Company. Material supplied is research grade, is not those medicines, and is not approved for human or veterinary use\u003c\/td\u003e\n\u003ctd\u003eResearch use compound, not approved for human or veterinary use in any jurisdiction, and appearing among the bulk drug substances withdrawn from consideration for compounding by the United States Food and Drug Administration\u003c\/td\u003e\n\u003c\/tr\u003e\n\u003c\/tbody\u003e\u003c\/table\u003e\n\u003cp\u003eRetatrutide is supplied exclusively for laboratory research use and is not intended for human or veterinary application.\u003c\/p\u003e\n\u003ch2\u003eLaboratory Handling and Storage Considerations\u003c\/h2\u003e\n\u003cp\u003eLyophilized Retatrutide should be stored sealed at 2 to 8 °C, protected from heat, light and moisture. The powder is hygroscopic, so vials should reach ambient temperature before opening to prevent condensation onto the cake. Acylated peptides of this class are surface active and can adsorb to plastic, so low binding labware is commonly selected. Prepared solutions should be aliquoted rather than cycled through freezing and thawing, and every container should carry identity, lot number and preparation date.\u003c\/p\u003e\n\n\u003ch3\u003eLaboratory Safety Considerations\u003c\/h3\u003e\n\u003cp\u003eThe practices below apply to routine handling in a research setting.\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003ePersonal protective equipment:\u003c\/strong\u003e Wear nitrile gloves, a laboratory coat and safety glasses whenever a vial is open.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eEngineering controls:\u003c\/strong\u003e Weigh and prepare solutions in a certified fume hood to limit powder dispersal.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eExposure prevention:\u003c\/strong\u003e Avoid skin, eye and mucous membrane contact and wash hands afterwards.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eStorage:\u003c\/strong\u003e Keep sealed vials at 2 to 8 °C in a dedicated research chemical location.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eSpill response:\u003c\/strong\u003e Collect spilled powder without raising dust and treat residue as chemical waste.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eDisposal:\u003c\/strong\u003e Discard unused material and contaminated consumables through the institutional chemical waste stream.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eDocumentation:\u003c\/strong\u003e Record lot number, receipt date and each preparation so results stay traceable to a batch.\u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003ch2\u003eCertificate of Analysis and Quality Assurance\u003c\/h2\u003e\n\u003cp\u003eEvery production lot of Retatrutide supplied by Peptsche undergoes analytical evaluation, and a batch specific Certificate of Analysis accompanies each order to support research documentation, quality control and experimental consistency.\u003c\/p\u003e\n\u003cp\u003eEach Certificate of Analysis typically includes:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eIdentity verification\u003c\/strong\u003e using analytical techniques such as mass spectrometry to confirm the molecular characteristics of the material supplied.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003ePurity analysis\u003c\/strong\u003e performed by high performance liquid chromatography to quantify purity and identify potential impurities.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eBatch documentation\u003c\/strong\u003e recording lot number, testing date, analytical methods applied and quality assessment results.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eTraceability information\u003c\/strong\u003e to support laboratory recordkeeping and reproducibility across research workflows.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003ePeptsche works with Janoshik Analytical, an independent testing laboratory, for third party verification of research material quality. Independent testing provides transparency and confidence in product identity, consistency and sourcing, and batch specific documentation can be retained as part of laboratory records and internal quality procedures.\u003c\/p\u003e\n\u003cp\u003eRetatrutide is supplied exclusively for laboratory research use and is not intended for human or veterinary application.\u003c\/p\u003e\n\n\u003ch2\u003eFrequently Asked Questions\u003c\/h2\u003e\n\u003ch3\u003eWhat is Retatrutide?\u003c\/h3\u003e\n\u003cp\u003eRetatrutide is a synthetic 39 residue peptide designed to act as a single molecule agonist at three separate receptors. It is an investigational compound in Phase 3 clinical development by Eli Lilly and Company, is not approved as a medicine in any jurisdiction and is not approved for human or veterinary use. Peptsche supplies it as a lyophilized powder sealed in a single use glass vial for controlled laboratory investigation.\u003c\/p\u003e\n\u003ch3\u003eWhat is Retatrutide studied for in research?\u003c\/h3\u003e\n\u003cp\u003ePublished laboratory work covers multiplexed receptor signalling assays run across parallel cell lines each expressing one target receptor, comparative pharmacology against single and dual receptor agonists, and analytical method development for acylated peptides. Because no pharmacopoeial monograph exists for this compound, method work relies on the batch Certificate of Analysis rather than an official standard. These describe areas of laboratory study rather than established outcomes outside those experimental systems.\u003c\/p\u003e\n\u003ch3\u003eHow does Retatrutide work in laboratory research?\u003c\/h3\u003e\n\u003cp\u003eIn the systems described in the literature the peptide activates the glucagon receptor, the glucose dependent insulinotropic polypeptide receptor and the glucagon like peptide 1 receptor, all three of which couple through stimulatory G protein to adenylate cyclase. Cyclic adenosine monophosphate accumulation therefore serves as the common readout across the three assays, and reported relative potency is unbalanced rather than equal. Alpha aminoisobutyric acid substitutions stabilise helical geometry against proteolytic cleavage and a twenty carbon diacid chain binds serum albumin reversibly.\u003c\/p\u003e\n\u003ch3\u003eHow is the quality of Peptsche Retatrutide verified?\u003c\/h3\u003e\n\u003cp\u003eEvery production lot of Peptsche Retatrutide is evaluated analytically, with identity confirmed using techniques such as mass spectrometry and purity quantified by high performance liquid chromatography against the stated specification of 99% or greater. Peptsche works with Janoshik Analytical, an independent testing laboratory, for third party verification, and a batch specific Certificate of Analysis accompanies each order.\u003c\/p\u003e\n\u003ch3\u003eHow should unopened Retatrutide be stored?\u003c\/h3\u003e\n\u003cp\u003eUnopened vials should be stored sealed at 2 to 8 °C, protected from heat, light and moisture. Vials should reach ambient temperature before opening so condensation does not form on the cold powder. Lot number, receipt date and storage conditions should be recorded in laboratory documentation so results stay traceable to a batch.\u003c\/p\u003e\n\u003ch3\u003eIs Retatrutide intended for human use?\u003c\/h3\u003e\n\u003cp\u003eNo. Retatrutide is supplied strictly for laboratory research use only. It is not approved for human consumption, veterinary use, diagnosis, treatment or any medical application.\u003c\/p\u003e\n\u003ch3\u003eWhy do researchers choose Peptsche for Retatrutide?\u003c\/h3\u003e\n\u003cp\u003ePeptsche supplies Retatrutide at 99% or greater purity by HPLC, verified per batch, as a lyophilized powder sealed in a single use glass vial that stays stable through transport and cold storage. Because no pharmacopoeial monograph exists for this compound, batch specific analytical documentation and independent third party confirmatory analysis are what support reproducibility across research workflows.\u003c\/p\u003e\n\n\u003ch2\u003eScientific References\u003c\/h2\u003e\n\u003col\u003e\n\u003cli\u003eCoskun T, Urva S, Roell WC, Qu H, Loghin C, Moyers JS, O'Farrell LS, Briere DA, et al. LY3437943, a novel triple glucagon, GIP, and GLP-1 receptor agonist for glycemic control and weight loss: From discovery to clinical proof of concept. Cell Metabolism. 2022;34(9):1234 to 1247. \u003ca href=\"https:\/\/pubmed.ncbi.nlm.nih.gov\/35985340\/\" target=\"_blank\" rel=\"noopener\"\u003ehttps:\/\/pubmed.ncbi.nlm.nih.gov\/35985340\/\u003c\/a\u003e\n\u003c\/li\u003e\n\u003cli\u003eUrva S, Coskun T, Loh MT, Du Y, Thomas MK, Gurbuz S, Haupt A, Benson CT, Hernandez-Illas M, D'Alessio DA, Milicevic Z. LY3437943, a novel triple GIP, GLP-1, and glucagon receptor agonist in people with type 2 diabetes: a phase 1b, multicentre, double-blind, placebo-controlled, randomised, multiple-ascending dose trial. The Lancet. 2022;400(10366):1869 to 1881. \u003ca href=\"https:\/\/pubmed.ncbi.nlm.nih.gov\/36354040\/\" target=\"_blank\" rel=\"noopener\"\u003ehttps:\/\/pubmed.ncbi.nlm.nih.gov\/36354040\/\u003c\/a\u003e\n\u003c\/li\u003e\n\u003cli\u003eJastreboff AM, Kaplan LM, Frías JP, Wu Q, Du Y, Gurbuz S, Coskun T, Haupt A, Milicevic Z, Hartman ML. Triple-Hormone-Receptor Agonist Retatrutide for Obesity, A Phase 2 Trial. New England Journal of Medicine. 2023;389(6):514 to 526. \u003ca href=\"https:\/\/pubmed.ncbi.nlm.nih.gov\/37366315\/\" target=\"_blank\" rel=\"noopener\"\u003ehttps:\/\/pubmed.ncbi.nlm.nih.gov\/37366315\/\u003c\/a\u003e\n\u003c\/li\u003e\n\u003c\/ol\u003e\n\n\u003ch2\u003eRESEARCH USE ONLY\u003c\/h2\u003e\n\u003cp\u003eThese compounds are NOT intended for human consumption, clinical use, or veterinary applications. We are not affiliated with any pharmaceutical companies or their commercial medications. By placing an order, you certify these materials will be used exclusively for in vitro testing and laboratory experimentation only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.\u003c\/p\u003e","brand":"Peptsche","offers":[{"title":"10mg","offer_id":43752812806207,"sku":"PEP-RETA-10MG","price":120.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0675\/7394\/0287\/files\/peptsche_Retatrutide_5mg.png?v=1786905447","url":"https:\/\/peptsche.com\/products\/retatrutide","provider":"Peptsche","version":"1.0","type":"link"}